https://peakpeptidesaustralia.com Research peptides and laboratory supplies from Peak Peptides Australia. For laboratory research use only. Not for human or veterinary use. bpc-157 BPC-157 10mg Lyophilised Peptide Vial - Research Use Only BPC-157 is a synthetic 15-amino-acid peptide (pentadecapeptide) supplied as freeze-dried research material. Molecular formula C62H98N16O22, molecular weight 1,419.5 g/mol, CAS 137525-51-0. Each sealed glass vial contains a stated 10mg of lyophilised powder. Independent LabDoc report LD-VN45 (tested 11 September 2026) confirmed identity by LC-MS, with 99.56% HPLC purity and 9.79mg measured against the 10mg label claim. The full report is linked on the product page. Store the sealed vial dry and protected from light at 2-8 °C, or at -20 °C for long-term storage. Supplied by Peak Peptides Australia. For laboratory research use only. Not for human or veterinary use. This product is not a medicine, food or dietary supplement and is not TGA- or FDA-approved. https://peakpeptidesaustralia.com/peptides/bpc-157-10mg https://peakpeptidesaustralia.com/api/images/bpc-157-10mg-44bce844.png new in_stock 100.00 AUD Peak Peptides Australia no Business & Industrial > Science & Laboratory > Laboratory Chemicals Research Supplies > Research Peptides > Individual Peptides AU Australia Post Express Post 15.00 AUD 0 1 1 3 30 g tb-500 TB-500 10mg Lyophilised Peptide Vial - Research Use Only TB-500 is an N-terminally acetylated seven-amino-acid peptide corresponding to residues 17-23 of thymosin beta-4. Sequence Ac-Leu-Lys-Lys-Thr-Glu-Thr-Gln-OH (Ac-LKKTETQ), CAS 885340-08-9 (free base). Each sealed glass vial contains a nominal 10mg of lyophilised powder. Independent LabDoc report LD-FTNC (tested 11 September 2026) confirmed identity by LC-MS, with 99.49% HPLC purity and 9.47mg measured against the 10mg label claim. The full report is linked on the product page. Store the sealed vial dry and protected from light at 2-8 °C, or at -20 °C for long-term storage. Supplied by Peak Peptides Australia. For laboratory research use only. Not for human or veterinary use. This product is not a medicine, food or dietary supplement and is not TGA- or FDA-approved. https://peakpeptidesaustralia.com/peptides/tb-500-10mg https://peakpeptidesaustralia.com/api/images/tb-500-10mg-d9ce1d52.png new in_stock 105.00 AUD Peak Peptides Australia no Business & Industrial > Science & Laboratory > Laboratory Chemicals Research Supplies > Research Peptides > Individual Peptides AU Australia Post Express Post 15.00 AUD 0 1 1 3 30 g cjc-1295 CJC-1295 No DAC (Mod GRF 1-29) 10mg Lyophilised Peptide Vial - Research Use Only CJC-1295 No DAC, also called Modified GRF (1-29), is a synthetic 29-amino-acid GHRH analogue without the albumin-binding DAC group, used in GHRH-receptor research. Each sealed glass vial contains a nominal 10mg of lyophilised powder. Independent LabDoc report LD-AYN4 (tested 11 September 2026) confirmed identity by LC-MS, with 99.38% HPLC purity and 9.13mg measured against the 10mg label claim. The full report is linked on the product page. Store the sealed vial dry and protected from light at 2-8 °C, or at -20 °C for long-term storage. Supplied by Peak Peptides Australia. For laboratory research use only. Not for human or veterinary use. This product is not a medicine, food or dietary supplement and is not TGA- or FDA-approved. https://peakpeptidesaustralia.com/peptides/cjc-1295-10mg https://peakpeptidesaustralia.com/api/images/cjc-1295-10mg-98ae9b15.png new in_stock 85.00 AUD Peak Peptides Australia no Business & Industrial > Science & Laboratory > Laboratory Chemicals Research Supplies > Research Peptides > Individual Peptides AU Australia Post Express Post 15.00 AUD 0 1 1 3 30 g ipamorelin Ipamorelin 10mg Lyophilised Peptide Vial - Research Use Only Ipamorelin is a synthetic pentapeptide studied at the GHS-R1a (ghrelin) receptor. Sequence Aib-His-D-2-Nal-D-Phe-Lys-NH2, molecular formula C38H49N9O5, molecular weight 711.9 g/mol, CAS 170851-70-4. Each sealed glass vial contains a 10mg labelled amount of lyophilised powder. Store the sealed vial dry and protected from light at 2-8 °C, or at -20 °C for long-term storage. Supplied by Peak Peptides Australia. For laboratory research use only. Not for human or veterinary use. This product is not a medicine, food or dietary supplement and is not TGA- or FDA-approved. https://peakpeptidesaustralia.com/peptides/ipamorelin-10mg https://peakpeptidesaustralia.com/api/images/ipamorelin-10mg-0feb22f3.png new backorder 80.00 AUD Peak Peptides Australia no Business & Industrial > Science & Laboratory > Laboratory Chemicals Research Supplies > Research Peptides > Individual Peptides AU Australia Post Express Post 15.00 AUD 0 1 1 3 30 g melanotan-ii Melanotan II 10mg Lyophilised Peptide Vial - Research Use Only Melanotan II (MT-II) is a synthetic cyclic seven-amino-acid analogue of alpha-MSH used in melanocortin receptor research. Sequence Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH2, molecular formula C50H69N15O9, molecular weight 1,024.2 g/mol, CAS 121062-08-6. Each sealed glass vial contains a nominal 10mg of lyophilised powder. Independent LabDoc report LD-VMH4 (tested 09 October 2026) confirmed identity by LC-MS, with 99.39% HPLC purity and 9.76mg measured against the 10mg label claim. The full report is linked on the product page. Store the sealed vial dry and protected from light at 2-8 °C, or at -20 °C for long-term storage. Supplied by Peak Peptides Australia. For laboratory research use only. Not for human or veterinary use. This product is not a medicine, food or dietary supplement and is not TGA- or FDA-approved. https://peakpeptidesaustralia.com/peptides/melanotan-ii-10mg https://peakpeptidesaustralia.com/api/images/melanotan-ii-10mg-1b552107.png new in_stock 50.00 AUD Peak Peptides Australia no Business & Industrial > Science & Laboratory > Laboratory Chemicals Research Supplies > Research Peptides > Individual Peptides AU Australia Post Express Post 15.00 AUD 0 1 1 3 30 g ghrp-6 GHRP-6 10mg Lyophilised Peptide Vial - Research Use Only GHRP-6 is a synthetic six-amino-acid peptide (hexapeptide) studied at the GHS-R1a (ghrelin) receptor. Sequence His-D-Trp-Ala-Trp-D-Phe-Lys-NH2, molecular formula C46H56N12O6, molecular weight 873.0 g/mol, CAS 87616-84-0. Each sealed glass vial contains a nominal 10mg of lyophilised powder. Store the sealed vial dry and protected from light at 2-8 °C, or at -20 °C for long-term storage. Supplied by Peak Peptides Australia. For laboratory research use only. Not for human or veterinary use. This product is not a medicine, food or dietary supplement and is not TGA- or FDA-approved. https://peakpeptidesaustralia.com/peptides/ghrp-6-10mg https://peakpeptidesaustralia.com/api/images/ghrp-6-10mg-eddeccf9.png new in_stock 80.00 AUD Peak Peptides Australia no Business & Industrial > Science & Laboratory > Laboratory Chemicals Research Supplies > Research Peptides > Individual Peptides AU Australia Post Express Post 15.00 AUD 0 1 1 3 30 g pt-141 PT-141 10mg Lyophilised Peptide Vial - Research Use Only PT-141 is a synthetic cyclic heptapeptide and melanocortin receptor agonist used in MC3R and MC4R research. Molecular formula C50H68N14O10, molecular weight 1,025.2 g/mol, CAS 189691-06-3. Each sealed glass vial contains a nominal 10mg of lyophilised powder. Independent LabDoc report LD-YZY4 (tested 21 October 2026) confirmed identity by LC-MS, with 99.45% HPLC purity and 9.54mg measured against the 10mg label claim. The full report is linked on the product page. Store the sealed vial dry and protected from light at -20 °C. Supplied by Peak Peptides Australia. For laboratory research use only. Not for human or veterinary use. This product is not a medicine, food or dietary supplement and is not TGA- or FDA-approved. https://peakpeptidesaustralia.com/peptides/pt-141-10mg https://peakpeptidesaustralia.com/api/images/pt-141-10mg-0ba56ce3.png new in_stock 85.00 AUD Peak Peptides Australia no Business & Industrial > Science & Laboratory > Laboratory Chemicals Research Supplies > Research Peptides > Individual Peptides AU Australia Post Express Post 15.00 AUD 0 1 1 3 30 g semax Semax 10mg Lyophilised Peptide Vial - Research Use Only Semax is a synthetic heptapeptide, ACTH(4-7)-Pro-Gly-Pro, used in neurotrophin signalling research. Sequence Met-Glu-His-Phe-Pro-Gly-Pro (MEHFPGP), molecular formula C37H51N9O10S, molecular weight 813.9 g/mol, CAS 80714-61-0. Each sealed glass vial contains a nominal 10mg of lyophilised powder. Independent LabDoc report LD-Z6HZ (tested 10 September 2026) confirmed identity by LC-MS, with 99.69% HPLC purity and 9.42mg measured against the 10mg label claim. The full report is linked on the product page. Store the sealed vial dry and protected from light at 2-8 °C, or at -20 °C for long-term storage. Supplied by Peak Peptides Australia. For laboratory research use only. Not for human or veterinary use. This product is not a medicine, food or dietary supplement and is not TGA- or FDA-approved. https://peakpeptidesaustralia.com/peptides/semax-10mg https://peakpeptidesaustralia.com/api/images/semax-10mg-faafea73.png new in_stock 85.00 AUD Peak Peptides Australia no Business & Industrial > Science & Laboratory > Laboratory Chemicals Research Supplies > Research Peptides > Individual Peptides AU Australia Post Express Post 15.00 AUD 0 1 1 3 30 g selank Selank 10mg Lyophilised Peptide Vial - Research Use Only Selank is a synthetic heptapeptide built on the tuftsin core sequence (TKPR) extended with Pro-Gly-Pro. Sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro (TKPRPGP). Each sealed glass vial contains a nominal 10mg of lyophilised powder. Independent LabDoc report LD-866B (tested 18 September 2026) confirmed identity by LC-MS, with 98.27% HPLC purity and 9.16mg measured against the 10mg label claim. The full report is linked on the product page. Store the sealed vial upright at 2-8 °C, protected from light. Supplied by Peak Peptides Australia. For laboratory research use only. Not for human or veterinary use. This product is not a medicine, food or dietary supplement and is not TGA- or FDA-approved. https://peakpeptidesaustralia.com/peptides/selank-10mg https://peakpeptidesaustralia.com/api/images/selank-10mg-46ef391c.png new in_stock 85.00 AUD Peak Peptides Australia no Business & Industrial > Science & Laboratory > Laboratory Chemicals Research Supplies > Research Peptides > Individual Peptides AU Australia Post Express Post 15.00 AUD 0 1 1 3 30 g hcg HCG 5000IU Lyophilised Powder Vial - Research Use Only Human chorionic gonadotropin (HCG) is a glycoprotein with alpha and beta subunits, used in LH/CG receptor signalling research. Reported molecular mass about 36,700-38,000 Da. The 5,000 IU label is a biological activity unit, not a weight. Each sealed glass vial contains 5,000 IU of lyophilised powder. Store the sealed vial dry and protected from light at 2-8 °C until the printed expiry. Supplied by Peak Peptides Australia. For laboratory research use only. Not for human or veterinary use. This product is not a medicine, food or dietary supplement and is not TGA- or FDA-approved. https://peakpeptidesaustralia.com/peptides/hcg-5000iu https://peakpeptidesaustralia.com/api/images/hcg-5000iu-615e079d.png new in_stock 90.00 AUD Peak Peptides Australia no Business & Industrial > Science & Laboratory > Laboratory Chemicals Research Supplies > Research Peptides > Individual Peptides AU Australia Post Express Post 15.00 AUD 0 1 1 3 30 g nad NAD+ 1000mg Lyophilised Powder Vial - Research Use Only NAD+ (nicotinamide adenine dinucleotide, oxidised form) is a dinucleotide coenzyme, not a peptide, used in redox and NAD-dependent enzyme research. Molecular formula C21H28N7O14P2+, molecular weight 664.4 g/mol, CAS 53-84-9, PubChem CID 5893. Each sealed amber glass vial contains a nominal 1000mg of powder. Independent LabDoc report LD-QCYH (tested 26 October 2026) confirmed identity by LC-MS, with 98.37% HPLC purity and 938.49mg measured against the 1000mg label claim. The full report is linked on the product page. Store the sealed vial dry and protected from light within the labelled temperature range. Supplied by Peak Peptides Australia. For laboratory research use only. Not for human or veterinary use. This product is not a medicine, food or dietary supplement and is not TGA- or FDA-approved. https://peakpeptidesaustralia.com/peptides/nad-1000mg https://peakpeptidesaustralia.com/api/images/nad-1000mg-0853b2e6.png new in_stock 160.00 AUD Peak Peptides Australia no Business & Industrial > Science & Laboratory > Laboratory Chemicals Research Supplies > Research Peptides > Individual Peptides AU Australia Post Express Post 15.00 AUD 0 1 1 3 30 g ghk-cu GHK-Cu 50mg Lyophilised Copper Peptide Vial - Research Use Only GHK-Cu is the copper complex of the tripeptide glycyl-L-histidyl-L-lysine (Gly-His-Lys:Cu), also called copper tripeptide-1. PubChem CID 133697840, molecular formula C28H48CuN12O8, molecular weight 744.3 g/mol. Each sealed glass vial contains a nominal 50mg of blue lyophilised powder. Independent LabDoc report LD-2CGW (tested 17 September 2026) confirmed identity by LC-MS, with 99.77% HPLC purity and 48.43mg measured against the 50mg label claim. The full report is linked on the product page. Store the sealed vial dry and protected from light at 2-8 °C, or at -20 °C for long-term storage. Supplied by Peak Peptides Australia. For laboratory research use only. Not for human or veterinary use. This product is not a medicine, food or dietary supplement and is not TGA- or FDA-approved. https://peakpeptidesaustralia.com/peptides/ghk-cu-50mg https://peakpeptidesaustralia.com/api/images/ghk-cu-50mg-518b05f8.png new in_stock 55.00 AUD Peak Peptides Australia no Business & Industrial > Science & Laboratory > Laboratory Chemicals Research Supplies > Research Peptides > Individual Peptides AU Australia Post Express Post 15.00 AUD 0 1 1 3 30 g mots-c-10mg MOTS-C 10mg Lyophilised Peptide Vial - Research Use Only MOTS-C is a 16-amino-acid mitochondrial-derived peptide encoded within the mitochondrial 12S rRNA, used in AMPK and cellular energy signalling research. Sequence MRWQEMGYIFYPRKLR. Each sealed glass vial contains a nominal 10mg of lyophilised powder. Independent LabDoc report LD-X67V (tested 11 September 2026) confirmed identity by LC-MS, with 98.86% HPLC purity and 9.69mg measured against the 10mg label claim. The full report is linked on the product page. Store the sealed vial dry and protected from light at -20 °C. Supplied by Peak Peptides Australia. For laboratory research use only. Not for human or veterinary use. This product is not a medicine, food or dietary supplement and is not TGA- or FDA-approved. https://peakpeptidesaustralia.com/peptides/mots-c-10mg https://peakpeptidesaustralia.com/api/images/mots-c-10mg-3e2c7a6c.png new in_stock 75.00 AUD Peak Peptides Australia no Business & Industrial > Science & Laboratory > Laboratory Chemicals Research Supplies > Research Peptides > Individual Peptides AU Australia Post Express Post 15.00 AUD 0 1 1 3 30 g ara-290-10mg ARA 290 10mg Lyophilised Peptide Vial - Research Use Only ARA 290 is a synthetic 11-amino-acid peptide derived from the helix B surface of erythropoietin, with an N-terminal pyroglutamate. Sequence XEQLERALNSS (X = pyroglutamate), molecular formula C51H84N16O21, molecular weight 1,257.3 g/mol, CAS 1208243-50-8. Each sealed glass vial contains a labelled 10mg of lyophilised powder. Independent LabDoc report LD-24XK (tested 02 October 2026) confirmed identity by LC-MS, with 99.3% HPLC purity and 9.47mg measured against the 10mg label claim. The full report is linked on the product page. Store the sealed vial at 2-8 °C, protected from light and moisture. Supplied by Peak Peptides Australia. For laboratory research use only. Not for human or veterinary use. This product is not a medicine, food or dietary supplement and is not TGA- or FDA-approved. https://peakpeptidesaustralia.com/peptides/ara-290-10mg https://peakpeptidesaustralia.com/api/images/ara-290-10mg-6d89ca25.png new in_stock 90.00 AUD Peak Peptides Australia no Business & Industrial > Science & Laboratory > Laboratory Chemicals Research Supplies > Research Peptides > Individual Peptides AU Australia Post Express Post 15.00 AUD 0 1 1 3 30 g thymosin-alpha-1-10mg Thymosin Alpha-1 10mg Lyophilised Peptide Vial - Research Use Only Thymosin Alpha-1 is an N-acetylated 28-amino-acid synthetic peptide. Sequence SDAAVDTSSEITTKDLKEKKEVVEEAEN, molecular formula C129H215N33O55, molecular weight 3,108.3 g/mol, CAS 62304-98-7. Each sealed glass vial contains a nominal 10mg of lyophilised powder. Independent LabDoc report LD-J82K (tested 11 September 2026) confirmed identity by LC-MS, with 99.67% HPLC purity and 9.4mg measured against the 10mg label claim. The full report is linked on the product page. Store the sealed vial dry and protected from light at 2-8 °C, or at -20 °C for long-term storage. Supplied by Peak Peptides Australia. For laboratory research use only. Not for human or veterinary use. This product is not a medicine, food or dietary supplement and is not TGA- or FDA-approved. https://peakpeptidesaustralia.com/peptides/thymosin-alpha-1-10mg https://peakpeptidesaustralia.com/api/images/thymosin-alpha-1-10mg-c292bedb.png new in_stock 175.00 AUD Peak Peptides Australia no Business & Industrial > Science & Laboratory > Laboratory Chemicals Research Supplies > Research Peptides > Individual Peptides AU Australia Post Express Post 15.00 AUD 0 1 1 3 30 g tesamorelin-10mg Tesamorelin 10mg Lyophilised Peptide Vial - Research Use Only Tesamorelin is a synthetic 44-amino-acid GHRH analogue used in GHRH-receptor research. Sequence YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL, molecular weight 5,136 g/mol, CAS 218949-48-5. Each sealed glass vial contains a nominal 10mg of lyophilised powder. Independent LabDoc report LD-SHXT (tested 23 September 2026) confirmed identity by LC-MS, with 99.61% HPLC purity and 9.16mg measured against the 10mg label claim. The full report is linked on the product page. Store the sealed vial at 2-8 °C, protected from light. Supplied by Peak Peptides Australia. For laboratory research use only. Not for human or veterinary use. This product is not a medicine, food or dietary supplement and is not TGA- or FDA-approved. https://peakpeptidesaustralia.com/peptides/tesamorelin-10mg https://peakpeptidesaustralia.com/api/images/tesamorelin-10mg-0c47a5dd.png new backorder 130.00 AUD Peak Peptides Australia no Business & Industrial > Science & Laboratory > Laboratory Chemicals Research Supplies > Research Peptides > Individual Peptides AU Australia Post Express Post 15.00 AUD 0 1 1 3 30 g kpv-10mg KPV 10mg Lyophilised Peptide Vial - Research Use Only KPV (Lys-Pro-Val) is a three-amino-acid peptide matching the C-terminal end of alpha-MSH, alpha-MSH(11-13). Molecular formula C16H30N4O4, molecular weight 342.43 g/mol, CAS 67727-97-3. Each sealed glass vial contains a nominal 10mg of lyophilised powder. Independent LabDoc report LD-B98X (tested 22 September 2026) confirmed identity by LC-MS, with 99.24% HPLC purity and 9.04mg measured against the 10mg label claim. The full report is linked on the product page. Store the sealed vial dry and protected from light at -20 °C. Supplied by Peak Peptides Australia. For laboratory research use only. Not for human or veterinary use. This product is not a medicine, food or dietary supplement and is not TGA- or FDA-approved. https://peakpeptidesaustralia.com/peptides/kpv-10mg https://peakpeptidesaustralia.com/api/images/kpv-10mg-e3343019.png new in_stock 85.00 AUD Peak Peptides Australia no Business & Industrial > Science & Laboratory > Laboratory Chemicals Research Supplies > Research Peptides > Individual Peptides AU Australia Post Express Post 15.00 AUD 0 1 1 3 30 g ss-31-10mg SS-31 10mg Lyophilised Peptide Vial - Research Use Only SS-31 is a synthetic mitochondria-targeted tetrapeptide. Sequence D-Arg-2,6-dimethyl-Tyr-Lys-Phe-NH2, molecular formula C32H49N9O5, molecular weight 639.8 g/mol, CAS 736992-21-5. Each sealed glass vial contains a nominal 10mg of lyophilised powder. Independent LabDoc report LD-HAFB (tested 21 October 2026) confirmed identity by LC-MS, with 99.52% HPLC purity and 9.51mg measured against the 10mg label claim. The full report is linked on the product page. Store the sealed vial upright at 2-8 °C, protected from light. Supplied by Peak Peptides Australia. For laboratory research use only. Not for human or veterinary use. This product is not a medicine, food or dietary supplement and is not TGA- or FDA-approved. https://peakpeptidesaustralia.com/peptides/ss-31-10mg https://peakpeptidesaustralia.com/api/images/ss-31-10mg-d6100784.png new in_stock 100.00 AUD Peak Peptides Australia no Business & Industrial > Science & Laboratory > Laboratory Chemicals Research Supplies > Research Peptides > Individual Peptides AU Australia Post Express Post 15.00 AUD 0 1 1 3 30 g mots-c-20mg MOTS-C 20mg Lyophilised Peptide Vial - Research Use Only MOTS-C is a 16-amino-acid mitochondrial-derived peptide encoded within the mitochondrial 12S rRNA, used in AMPK and cellular energy signalling research. Sequence MRWQEMGYIFYPRKLR. Each sealed glass vial contains a labelled 20mg of lyophilised powder. Independent LabDoc report LD-WPTB (tested 10 September 2026) confirmed identity by LC-MS, with 99.49% HPLC purity and 18.14mg measured against the 20mg label claim. The full report is linked on the product page. Store the sealed vial dry and protected from light at -20 °C. Supplied by Peak Peptides Australia. For laboratory research use only. Not for human or veterinary use. This product is not a medicine, food or dietary supplement and is not TGA- or FDA-approved. https://peakpeptidesaustralia.com/peptides/mots-c-20mg https://peakpeptidesaustralia.com/api/images/mots-c-20mg-4f2f5c82.png new in_stock 140.00 AUD Peak Peptides Australia no Business & Industrial > Science & Laboratory > Laboratory Chemicals Research Supplies > Research Peptides > Individual Peptides AU Australia Post Express Post 15.00 AUD 0 1 1 3 30 g dsip-10mg DSIP 10mg Lyophilised Peptide Vial - Research Use Only DSIP is a defined synthetic nine-amino-acid peptide (nonapeptide). Sequence Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu (WAGGDASGE), molecular formula C35H48N10O15, molecular weight 848.8 g/mol, CAS 62568-57-4, PubChem CID 68816. Each sealed glass vial contains a nominal 10mg of lyophilised powder. Independent LabDoc report LD-H89L (tested 28 September 2026) confirmed identity by LC-MS, with 99.45% HPLC purity and 9.22mg measured against the 10mg label claim. The full report is linked on the product page. Store the sealed vial dry and protected from light at -20 °C. Supplied by Peak Peptides Australia. For laboratory research use only. Not for human or veterinary use. This product is not a medicine, food or dietary supplement and is not TGA- or FDA-approved. https://peakpeptidesaustralia.com/peptides/dsip-10mg https://peakpeptidesaustralia.com/api/images/dsip-10mg-56ef99c2.png new in_stock 85.00 AUD Peak Peptides Australia no Business & Industrial > Science & Laboratory > Laboratory Chemicals Research Supplies > Research Peptides > Individual Peptides AU Australia Post Express Post 15.00 AUD 0 1 1 3 30 g igf-1-lr3-1mg IGF-1 LR3 1mg Lyophilised Peptide Vial - Research Use Only IGF-1 LR3 (Long R3 IGF-I) is an engineered 83-amino-acid analogue of IGF-I, with a 13-residue N-terminal extension and arginine at position 3, used in IGF-system and cell-signalling research. Molecular weight about 9,108-9,112 Da. The specified solvent is 100 mM (0.6%) acetic acid, not bacteriostatic water. Each sealed glass vial contains a nominal 1mg of lyophilised powder. Store the sealed vial at 2-8 °C, protected from light. Supplied by Peak Peptides Australia. For laboratory research use only. Not for human or veterinary use. This product is not a medicine, food or dietary supplement and is not TGA- or FDA-approved. https://peakpeptidesaustralia.com/peptides/igf-1-lr3-1mg https://peakpeptidesaustralia.com/api/images/igf-1-lr3-1mg-bc37f362.png new in_stock 210.00 AUD Peak Peptides Australia no Business & Industrial > Science & Laboratory > Laboratory Chemicals Research Supplies > Research Peptides > Individual Peptides AU Australia Post Express Post 15.00 AUD 0 1 1 3 30 g sermorelin-10mg Sermorelin 10mg Lyophilised Peptide Vial - Research Use Only Sermorelin, GHRH(1-29)-NH2, is an amidated 29-amino-acid fragment of human GHRH used in GHRH-receptor research. Sequence YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2, molecular formula C149H246N44O42S, molecular weight 3,357.9 g/mol, CAS 86168-78-7. Each sealed glass vial contains a nominal 10mg of lyophilised powder. Store the sealed vial at 2-8 °C, protected from light. Supplied by Peak Peptides Australia. For laboratory research use only. Not for human or veterinary use. This product is not a medicine, food or dietary supplement and is not TGA- or FDA-approved. https://peakpeptidesaustralia.com/peptides/sermorelin-10mg https://peakpeptidesaustralia.com/api/images/sermorelin-10mg-28d5fd4d.png new in_stock 85.00 AUD Peak Peptides Australia no Business & Industrial > Science & Laboratory > Laboratory Chemicals Research Supplies > Research Peptides > Individual Peptides AU Australia Post Express Post 15.00 AUD 0 1 1 3 30 g epithalon-10mg Epithalon 10mg Lyophilised Peptide Vial - Research Use Only Epithalon (Epitalon) is a defined synthetic tetrapeptide, Ala-Glu-Asp-Gly (AEDG), used in telomerase cell research. Molecular formula C14H22N4O9, molecular weight 390.35 g/mol, CAS 307297-39-8, PubChem CID 219042. Each sealed glass vial contains a nominal 10mg of lyophilised powder. Independent LabDoc report LD-U2Y8 (tested 28 September 2026) confirmed identity by LC-MS, with 98.2% HPLC purity and 9.34mg measured against the 10mg label claim. The full report is linked on the product page. Store the sealed vial dry and protected from light at 2-8 °C, or at -20 °C for long-term storage. Supplied by Peak Peptides Australia. For laboratory research use only. Not for human or veterinary use. This product is not a medicine, food or dietary supplement and is not TGA- or FDA-approved. https://peakpeptidesaustralia.com/peptides/epithalon-10mg https://peakpeptidesaustralia.com/api/images/epithalon-10mg-76d1d2e4.png new in_stock 80.00 AUD Peak Peptides Australia no Business & Industrial > Science & Laboratory > Laboratory Chemicals Research Supplies > Research Peptides > Individual Peptides AU Australia Post Express Post 15.00 AUD 0 1 1 3 30 g slu-pp-332-5mg SLU-PP-332 5mg Research Compound Powder Vial - Research Use Only SLU-PP-332 is a synthetic small-molecule pan-ERR (estrogen-related receptor) agonist, not a peptide. Chemical name 4-hydroxy-N'-(naphthalen-2-ylmethylene)benzohydrazide, molecular formula C18H14N2O2, molecular weight 290.3 g/mol, CAS 303760-60-3. Each sealed glass vial contains 5mg of powder. Independent LabDoc report LD-ZLZU (tested 06 October 2026) confirmed identity by LC-MS, with 99.6% HPLC purity and 4.63mg measured against the 5mg label claim. The full report is linked on the product page. Store the sealed vial dry and protected from light at -20 °C. Supplied by Peak Peptides Australia. For laboratory research use only. Not for human or veterinary use. This product is not a medicine, food or dietary supplement and is not TGA- or FDA-approved. https://peakpeptidesaustralia.com/peptides/slu-pp-332-5mg https://peakpeptidesaustralia.com/api/images/slu-pp-332-5mg-ff42696f.png new in_stock 115.00 AUD Peak Peptides Australia no Business & Industrial > Science & Laboratory > Laboratory Chemicals Research Supplies > Research Peptides > Individual Peptides AU Australia Post Express Post 15.00 AUD 0 1 1 3 30 g aod-9604-10mg AOD 9604 10mg Lyophilised Peptide Vial - Research Use Only AOD 9604 is a modified synthetic 16-amino-acid peptide with a cysteine-to-cysteine disulphide link. Sequence YLRIVQCRSVEGSCGF, molecular formula C78H123N23O23S2 (acetate), molecular weight 1,815.1 g/mol. Each pack contains a labelled 10mg of lyophilised powder in a sealed glass vial, plus one 3 mL vial of the supplied acidic solution. Independent LabDoc report LD-9KXJ (tested 02 October 2026) confirmed identity by LC-MS, with 98.96% HPLC purity and 9.13mg measured against the 10mg label claim. The full report is linked on the product page. Store the sealed vial dry and protected from light at 2-8 °C, or at -20 °C for long-term storage. Supplied by Peak Peptides Australia. For laboratory research use only. Not for human or veterinary use. This product is not a medicine, food or dietary supplement and is not TGA- or FDA-approved. https://peakpeptidesaustralia.com/peptides/aod-9604-10mg https://peakpeptidesaustralia.com/api/images/aod-9604-10mg-1bb07088.png new in_stock 160.00 AUD Peak Peptides Australia no Business & Industrial > Science & Laboratory > Laboratory Chemicals Research Supplies > Research Peptides > Individual Peptides AU Australia Post Express Post 15.00 AUD 0 1 1 3 30 g oxytocin-10mg Oxytocin 10mg Lyophilised Peptide Vial - Research Use Only Oxytocin is a nine-amino-acid peptide (nonapeptide) with a Cys1-Cys6 disulfide bridge, used in oxytocin receptor (OXTR) research. Sequence Cys-Tyr-Ile-Gln-Asn-Cys-Pro-Leu-Gly-NH2, molecular formula C43H66N12O12S2, molecular weight 1,007.2 g/mol. Each sealed clear glass vial contains a nominal 10mg of lyophilised powder. Independent LabDoc report LD-AKXA (tested 19 October 2026) confirmed identity by LC-MS, with 99.68% HPLC purity and 9.5mg measured against the 10mg label claim. The full report is linked on the product page. Store the sealed vial dry and protected from light at 2-8 °C, or at -20 °C for long-term storage. Supplied by Peak Peptides Australia. For laboratory research use only. Not for human or veterinary use. This product is not a medicine, food or dietary supplement and is not TGA- or FDA-approved. https://peakpeptidesaustralia.com/peptides/oxytocin-10mg https://peakpeptidesaustralia.com/api/images/oxytocin-10mg-bb037a1e.png new in_stock 160.00 AUD Peak Peptides Australia no Business & Industrial > Science & Laboratory > Laboratory Chemicals Research Supplies > Research Peptides > Individual Peptides AU Australia Post Express Post 15.00 AUD 0 1 1 3 30 g cagrilintide-10mg Cagrilintide 5mg Lyophilised Peptide Vial - Research Use Only Cagrilintide is a long-acting, lipidated amylin analogue used in amylin receptor research. Molecular formula C194H312N54O59S2, molecular weight about 4,409 g/mol, CAS 1415456-99-3, PubChem CID 171397054. Each sealed glass vial contains a labelled 5mg of lyophilised powder. Independent LabDoc report LD-5S5D (tested 18 September 2026) confirmed identity by LC-MS, with 99.07% HPLC purity and 4.49mg measured against the 5mg label claim. The full report is linked on the product page. Store the sealed vial frozen, protected from moisture and light. Supplied by Peak Peptides Australia. For laboratory research use only. Not for human or veterinary use. This product is not a medicine, food or dietary supplement and is not TGA- or FDA-approved. https://peakpeptidesaustralia.com/peptides/cagrilintide-10mg https://peakpeptidesaustralia.com/api/images/cagrilintide-5mg-d202ee24.png new in_stock 100.00 AUD Peak Peptides Australia no Business & Industrial > Science & Laboratory > Laboratory Chemicals Research Supplies > Research Peptides > Individual Peptides AU Australia Post Express Post 15.00 AUD 0 1 1 3 30 g pnc-27-10mg PNC-27 10mg Lyophilised Peptide Vial - Research Use Only PNC-27 is a synthetic 32-amino-acid peptide combining p53 residues 12-26 with a 17-amino-acid membrane residency sequence, used in HDM-2 (MDM2) cell-model research. Sequence PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG. Each sealed glass vial contains a nominal 10mg of lyophilised powder. Store the sealed vial dry and protected from light at 2-8 °C, or at -20 °C for long-term storage. Supplied by Peak Peptides Australia. For laboratory research use only. Not for human or veterinary use. This product is not a medicine, food or dietary supplement and is not TGA- or FDA-approved. https://peakpeptidesaustralia.com/peptides/pnc-27-10mg https://peakpeptidesaustralia.com/api/images/pnc-27-10mg-047d6b52.png new in_stock 180.00 AUD Peak Peptides Australia no Business & Industrial > Science & Laboratory > Laboratory Chemicals Research Supplies > Research Peptides > Individual Peptides AU Australia Post Express Post 15.00 AUD 0 1 1 3 30 g pe-22-28-10mg PE-22-28 10mg Lyophilised Peptide Vial - Research Use Only PE-22-28 is a synthetic, spadin-derived seven-amino-acid peptide. Sequence Gly-Val-Ser-Trp-Gly-Leu-Arg (GVSWGLR), molecular formula C35H55N11O9, formula weight 773.9 (acetate). Each sealed glass vial contains a nominal 10mg of lyophilised powder. Independent LabDoc report LD-UVDL (tested 26 October 2026) confirmed identity by LC-MS, with 99.68% HPLC purity and 9.2mg measured against the 10mg label claim. The full report is linked on the product page. Store the sealed vial dry, protected from light, at 2-8 °C. Supplied by Peak Peptides Australia. For laboratory research use only. Not for human or veterinary use. This product is not a medicine, food or dietary supplement and is not TGA- or FDA-approved. https://peakpeptidesaustralia.com/peptides/pe-22-28-10mg https://peakpeptidesaustralia.com/api/images/pe-22-28-10mg-d64dfd43.png new in_stock 100.00 AUD Peak Peptides Australia no Business & Industrial > Science & Laboratory > Laboratory Chemicals Research Supplies > Research Peptides > Individual Peptides AU Australia Post Express Post 15.00 AUD 0 1 1 3 30 g bpc-tb-blend BPC-157 5mg + TB-500 5mg Lyophilised Peptide Blend Vial 10mg - Research Use Only A fixed 1:1 research blend of two synthetic peptides in one vial: BPC-157 (15 amino acids) and TB-500 (acetylated thymosin beta-4 fragment, Ac-LKKTETQ). Label composition BPC-157 5mg + TB-500 5mg = 10mg total. Each sealed glass vial contains a nominal 10mg of lyophilised blend powder. Independent LabDoc report LD-ZACL (tested 20 October 2026) confirmed both components by LC-MS, with 99.79% whole-vial HPLC purity and measured content of BPC-157 4.69mg, TB-500 4.659mg. The full report is linked on the product page. Store the sealed vial dry and protected from light at 2-8 °C, or at -20 °C for long-term storage. Supplied by Peak Peptides Australia. For laboratory research use only. Not for human or veterinary use. This product is not a medicine, food or dietary supplement and is not TGA- or FDA-approved. https://peakpeptidesaustralia.com/peptides/wolverine-stack https://peakpeptidesaustralia.com/api/images/wolverine-stack-9c481646.png new backorder 115.00 AUD Peak Peptides Australia no Business & Industrial > Science & Laboratory > Laboratory Chemicals Research Supplies > Research Peptides > Peptide Blends AU Australia Post Express Post 15.00 AUD 0 1 1 3 30 g cjc-ipa-blend CJC-1295 No DAC 5mg + Ipamorelin 5mg Lyophilised Peptide Blend Vial 10mg - Research Use Only A fixed research blend of two synthetic peptides in one vial: CJC-1295 No DAC (Modified GRF 1-29, a GHRH analogue) and Ipamorelin (a GHS-R1a pentapeptide). Label composition CJC-1295 No DAC 5mg + Ipamorelin 5mg = 10mg total. Each sealed glass vial contains a nominal 10mg of lyophilised blend powder. Independent LabDoc report LD-MQQ4 (tested 26 October 2026) confirmed both components by LC-MS, with 99.45% whole-vial HPLC purity and measured content of CJC 4.66mg, Ipamorelin 4.61mg. The full report is linked on the product page. Store the sealed vial dry and protected from light at -20 °C. Supplied by Peak Peptides Australia. For laboratory research use only. Not for human or veterinary use. This product is not a medicine, food or dietary supplement and is not TGA- or FDA-approved. https://peakpeptidesaustralia.com/peptides/muscle-blend https://peakpeptidesaustralia.com/api/images/muscle-blend-2de86771.png new in_stock 115.00 AUD Peak Peptides Australia no Business & Industrial > Science & Laboratory > Laboratory Chemicals Research Supplies > Research Peptides > Peptide Blends AU Australia Post Express Post 15.00 AUD 0 1 1 3 30 g ultimate-blend KLOW Blend 80mg: GHK-Cu 50mg + BPC-157 10mg + TB-500 10mg + KPV 10mg Lyophilised Vial - Research Use Only KLOW is a fixed-ratio four-component research blend in one vial: GHK-Cu (copper tripeptide), BPC-157, TB-500 and KPV (Lys-Pro-Val). Label composition GHK-Cu 50mg + BPC-157 10mg + TB-500 10mg + KPV 10mg = 80mg total, a 5:1:1:1 ratio by mass. Each sealed glass vial contains a nominal 80mg of blue lyophilised blend powder. Independent LabDoc report LD-E6HW (tested 02 October 2026) confirmed all 4 components by LC-MS, with 99.47% whole-vial HPLC purity and measured content of GHK-Cu 46.19mg, TB-500 9.39mg, BPC-157 9.33mg, KPV 9.5mg. The full report is linked on the product page. Store the sealed vial dry and protected from light at 2-8 °C, or at -20 °C for long-term storage. Supplied by Peak Peptides Australia. For laboratory research use only. Not for human or veterinary use. This product is not a medicine, food or dietary supplement and is not TGA- or FDA-approved. https://peakpeptidesaustralia.com/peptides/klow-blend https://peakpeptidesaustralia.com/api/images/klow-blend-256387c2.png new in_stock 195.00 AUD Peak Peptides Australia no Business & Industrial > Science & Laboratory > Laboratory Chemicals Research Supplies > Research Peptides > Peptide Blends AU Australia Post Express Post 15.00 AUD 0 1 1 3 30 g bac-water Bacteriostatic Water 10mL (0.9% Benzyl Alcohol) Sterile Diluent Vial - Research Use Only Bacteriostatic water (BAC water) is sterile water with 0.9% benzyl alcohol preservative, supplied as a laboratory diluent for compatible research materials. It is not a peptide. Each sealed vial contains 10 mL of sterile bacteriostatic water. Store as printed on the vial and use before the printed expiry. Supplied by Peak Peptides Australia. For laboratory research use only. Not for human or veterinary use. This product is not a medicine, food or dietary supplement and is not TGA- or FDA-approved. https://peakpeptidesaustralia.com/peptides/bacteriostatic-water-10ml https://peakpeptidesaustralia.com/api/images/bacteriostatic-water-10ml-8d91251d.png new in_stock 15.00 AUD Peak Peptides Australia no Business & Industrial > Science & Laboratory > Laboratory Supplies Research Supplies > Accessories AU Australia Post Express Post 15.00 AUD 0 1 1 3 50 g