Sermorelin (Growth Hormone-Releasing Hormone Analog)
Sermorelin 10mg is a GHRH(1-29)-NH2 research peptide for examining anterior-pituitary and growth-hormone signalling. In-stock orders receive same-day dispatch from Victoria after payment confirmation, with tracked Australia Post Express shipping Australia-wide.
GHRH(1-29)-NH2 · anterior-pituitary signalling research
Sermorelin is a synthetic, amidated 29-amino-acid version of the active opening section of human growth hormone-releasing hormone, often written GHRH(1-29)-NH2 or GRF(1-29)-NH2. It is used in research that examines how a GHRH signal reaches the anterior pituitary and prompts measured growth-hormone release. Sermorelin is not human growth hormone: it acts upstream of that hormone. This 10mg listing contains a nominal 10 mg freeze-dried vial and is supplied for in-vitro research only, not for human or animal use. Below you can find its Geref medicine history, the published human findings, a clear comparison with Tesamorelin and CJC-1295 NO DAC, the exact 29-residue sequence, a 3 mL BAC-water concentration chart, and an eight-step photo guide.
Also referred to in research or catalogue references as Sermorelin, Sermoreline, GHRH(1-29)-NH2, GRF(1-29)-NH2, Growth hormone-releasing factor (1-29) amide, Sermorelin peptide, Sermorelin 10mg, Sermorelin 10 mg, Sermorelin acetate, Geref, GHRH 1-29, GRF 1-29.
Sermorelin is GHRH(1-29)-NH2: the amidated first 29 building blocks of human growth hormone-releasing hormone. PubChem lists the sequence as YADAIFTNSYRKVLGQLSARKLLQDIMSR, formula C149H246N44O42S, molecular weight 3,357.9 g/mol and CAS number 86168-78-7.
Sermorelin is not somatropin or human growth hormone. It reproduces a GHRH signal that acts at the anterior pituitary. In a healthy-volunteer physiology study, GHRH(1-29)-NH2 produced a measurable growth-hormone response after intravenous or intranasal administration.
A pharmacokinetic paper reported a 6.2-minute half-life for the parent growth hormone-releasing factor(1-29)-amide after intravenous administration in the tested model. A half-life describes how quickly the molecule leaves circulation; it is not the same thing as the duration of the growth-hormone signal.
Specific sermorelin acetate Geref products were FDA-approved: a diagnostic ampoule in 1990 and 0.5 mg and 1.0 mg vials for children with idiopathic growth-hormone deficiency in 1997. EMD Serono discontinued them in 2008; FDA withdrew both approvals effective 18 June 2009. In 2013 FDA found they were not withdrawn for safety or effectiveness reasons.
In a 1996 multicentre open-label study, 110 prepubertal children with growth-hormone deficiency entered and 86 were analysed for efficacy. Mean annualised height velocity changed from 4.1 cm/year at baseline to 8.0 at six months and 7.2 at 12 months. That result belongs to the tested childhood population and Geref-era study material.
Tesamorelin is a separate, stabilised 44-amino-acid GHRH analogue. CJC-1295 NO DAC is also a separate 29-amino-acid modified GRF(1-29) molecule. Their study findings, molecular details, labelled amounts and Quality/COA records do not transfer to Sermorelin.
The 10mg label describes the nominal total material in this listing. With the 3 mL BAC-water reference mix used by PeptideDosages, the calculated concentration is 3.33 mg/mL; a U-100 syringe marking is a volume marking, so one unit is 0.01 mL and represents about 0.033 mg.
This listing has no product-specific LabDoc report. The available Quality/COA documentation is on the Quality page. A certificate covers the tested material, method, report details and supplier linkage.
Sermorelin is a lab-made copy of the active opening portion of human growth hormone-releasing hormone, or GHRH. The complete human GHRH molecule has 44 amino acids. Sermorelin consists of the first 29, with an amide group at the end. That is why its scientific names include GHRH(1-29)-NH2 and GRF(1-29)-NH2.
A peptide is a short chain of amino acids, the small building blocks used to make proteins and hormones. Sermorelin’s one-letter sequence is YADAIFTNSYRKVLGQLSARKLLQDIMSR. PubChem identifies the material as C149H246N44O42S, with a computed molecular weight of 3,357.9 g/mol and CAS number 86168-78-7.
This listing identifies a nominal 10 mg Sermorelin research vial. Nominal means the quantity named on the label. It does not replace sample-specific analytical evidence, establish a clinical presentation or make a result from a published study apply to the vial. Peak Peptides Australia supplies the material for in-vitro research only.
Sermorelin works by copying a GHRH signal. GHRH is made in the hypothalamus, an area of the brain that communicates with the anterior pituitary. The anterior pituitary is a small gland that releases several hormones. Sermorelin is therefore upstream of growth hormone rather than being growth hormone itself.
In a human physiology study, researchers administered GHRH(1-29)-NH2 to 30 healthy men and measured growth hormone in blood. The lowest intravenous amount tested produced significant growth-hormone release. The peptide was rapidly eliminated after intravenous administration, but growth-hormone levels stayed elevated for about three hours in that experiment.
The key research distinction is between a pathway signal and a final outcome. A rise in measured growth hormone shows that the tested GHRH–pituitary pathway responded in that setting. It does not turn Sermorelin into human growth hormone or prove a separate body-composition, performance, sleep or anti-ageing outcome.
The clearest historical result for Sermorelin itself comes from Geref-era paediatric research. In a 1996 multicentre open-label study, 110 previously untreated prepubertal children with growth-hormone deficiency received GHRH(1-29) for up to one year. Eighty-six children were included in the efficacy analysis. Their average annualised height velocity was 4.1 cm/year before the study, 8.0 cm/year at six months and 7.2 cm/year at 12 months.
Those numbers belong to a specific group: prepubertal children with diagnosed growth-hormone deficiency using the study material and conditions reported by the authors. They are not a result for this 10 mg research vial, an estimate for adults, or a measurement that can be moved to a different molecule.
A separate six-month controlled study of growth hormone-releasing hormone in 89 healthy older adults reported improvements in several cognitive-test measures, including WAIS-R performance IQ and picture arrangement. That paper studied GHRH and cognition in its own population.
The table keeps the paediatric evidence easy to read while preserving its setting. Reporting the study population, duration and endpoint matters because results for height velocity, hormone levels and cognitive tests answer different questions.
| Study | Who was studied | Length | What was measured | Reported finding |
|---|---|---|---|---|
| Thorner et al., 1996 | 110 prepubertal children with growth-hormone deficiency; 86 in efficacy analysis | Up to 12 months | Annualised height velocity | 4.1 cm/year at baseline; 8.0 at six months; 7.2 at 12 months |
| Wilton et al., 1993 | 30 healthy men aged 19–43 years | Physiology experiment | Growth-hormone response and pharmacokinetics | Significant GH release after intravenous GHRH(1-29)-NH2; peptide rapidly eliminated |
| Vitiello et al., 2006 | 89 healthy older adults | Six months | Cognitive-test performance | Improvements reported in several tests, including performance IQ |
Each row identifies the study population and endpoint. None is a test report for the Sermorelin 10mg research listing.
Sermorelin, Tesamorelin and CJC-1295 NO DAC are often grouped together because each appears in GHRH-related research. They are not the same molecule. A comparison is useful only when it keeps the exact molecule and evidence attached to the correct name.
Sermorelin is the amidated GHRH(1-29) fragment. Tesamorelin is a stabilised 44-amino-acid GHRH analogue. PubChem lists Tesamorelin as 5,136 g/mol and shows a 44-residue sequence, compared with Sermorelin’s 3,357.9 g/mol and 29-residue sequence. The added length and stabilisation mean milligram quantities and study findings cannot be swapped.
CJC-1295 NO DAC is commonly described as modified GRF(1-29). It is separate from Sermorelin despite the same 29-amino-acid length. The ‘NO DAC’ name distinguishes it from a longer-acting albumin-binding form; it does not make it Sermorelin. Keep product labels, sequence, formulation and analytical reports tied to the material actually studied.
| Feature | Sermorelin | Tesamorelin | CJC-1295 NO DAC |
|---|---|---|---|
| Scientific identity | GHRH(1-29)-NH2 | Stabilised GHRH analogue | Modified GRF(1-29) |
| Length | 29 amino acids | 44 amino acids | 29 amino acids |
| Same molecule as Sermorelin? | Yes | No | No |
| Peak Peptides listing | Sermorelin 10mg | Tesamorelin 10mg | CJC-1295 NO DAC 10mg |
Compare evidence within a named molecule; do not carry a result, nominal amount, storage assumption or analytical report across listings.
Sermorelin’s sequence is YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2. The letters stand for amino acids: for example, Y is tyrosine, A is alanine, D is aspartic acid and R is arginine. The ending NH2 means the final arginine has an amidated C-terminus, a defining part of the named molecule.
PubChem lists the free-base molecular formula as C149H246N44O42S, the molecular weight as 3,357.9 g/mol and CAS number 86168-78-7. The acetate salt is a related record and is not something this product listing establishes for the supplied vial. Chemical names, salt forms and measured product content are separate pieces of information.
Sequence information is useful for identity research. It does not replace a sample-specific identity result. When an analytical report is available, LC-MS is commonly used to compare mass information and HPLC is commonly used to report purity; those methods and their result belong to the sample that the laboratory received.
Sermorelin has a specific regulatory history in the United States. FDA records identify Geref Sermorelin acetate diagnostic ampoules as initially approved in 1990 and 0.5 mg and 1.0 mg Geref vials as initially approved in 1997 for children with growth failure from idiopathic growth-hormone deficiency. EMD Serono notified FDA in 2008 that it was discontinuing these products. FDA withdrew the two approvals effective 18 June 2009.
The historical record is precise: it does not say that Geref was stopped for safety or effectiveness reasons. In 2013 FDA reviewed the withdrawal and determined that the Geref products were not withdrawn from sale for reasons of safety or effectiveness. It also does not make a current research vial an approved medicine, a replica of the historical presentation or a substitute for its records.
In Australia, the TGA says the Australian Register of Therapeutic Goods, or ARTG, is the public database of therapeutic goods approved for legal supply. This Sermorelin 10mg listing is not presented as an FDA- or TGA-approved medicine and is supplied for in-vitro research only. The WADA Prohibited List includes Sermorelin among growth hormone-releasing factors under S2.2.4, prohibited at all times.
No product-specific LabDoc report is published for this listing. The Quality page provides available Quality/COA documentation. Check that any report names the material tested, identifies the laboratory method and connects to the relevant supplier.
Step-by-step guide · About 10 minutes
Sermorelin 10mg is shown as freeze-dried material. Reconstitution means adding a measured liquid so the powder becomes a clear solution for laboratory measurement. PeptideDosages uses 3 mL of bacteriostatic (BAC) water as its Sermorelin 10mg concentration example. That makes 3.33 mg/mL, where 30 U-100 syringe units equal 1 mg. Follow the eight visual handling steps below and keep the product-specific label or quality information with the vial.
The vial’s nominal 10 mg stays the same whichever liquid volume is used. More BAC water creates a lower concentration, so each U-100 unit represents less material. Less BAC water creates a higher concentration. The chart uses 1 mL, 2 mL and the 3 mL PeptideDosages reference mix so the arithmetic can be checked at a glance.
With 3 mL, the concentration is 3.33 mg/mL. A U-100 syringe has 100 units per mL, so one unit is 0.01 mL and contains about 0.033 mg, or 33.33 mcg. At that concentration, 0.25 mg is 7.5 units, 0.5 mg is 15 units, 1 mg is 30 units and 2 mg is 60 units. With 2 mL, 1 mg is 20 units; with 1 mL, 1 mg is 10 units.
| BAC water added | Strength | 1 unit holds | Units for 1 mg | Whole vial |
|---|---|---|---|---|
| 1 mL | 10 mg/mL | 0.1 mg (100 mcg) | 10 units | 100 units |
| 2 mL | 5 mg/mL | 0.05 mg (50 mcg) | 20 units | 200 units |
| 3 mL | 3.33 mg/mL | 0.033 mg (33.33 mcg) | 30 units | 300 units |
3 mL is highlighted because it gives the simplest numbers.
| Amount | Units on a U-100 syringe | Volume |
|---|---|---|
| 0.25 mg | 7.5 units | 0.075 mL |
| 0.5 mg | 15 units | 0.15 mL |
| 1 mg | 30 units | 0.3 mL |
| 2 mg | 60 units | 0.6 mL |
Place the Sermorelin 10mg vial, BAC water, a new 1 mL U-100 syringe, alcohol swabs and a sharps container on a clean work surface. Keep the product label and preparation record visible. The photo shows the materials used in the 3 mL reference-mix example; make sure all containers are intact before starting.
Remove the flip-off cap if present, then wipe the rubber stopper of the Sermorelin vial and the BAC-water vial with fresh alcohol swabs. Let the stoppers air-dry for about 30 seconds. Avoid touching the cleaned rubber surfaces after swabbing, and keep the removed cap beside the vial rather than on the stopper.
Use the U-100 syringe to measure BAC water. The 3 mL reference mix requires three separate 1 mL fills because a standard 1 mL U-100 syringe holds 100 units, which equals 1 mL. Check for air bubbles and verify the volume line each time; the syringe unit marks describe liquid volume, not peptide activity.
Angle the Sermorelin vial so the needle tip rests against the inside wall. Press the plunger slowly and let the liquid travel down the glass instead of directing a hard stream onto the freeze-dried material. Repeat the measured transfer until the intended final volume is reached, keeping the vial label visible for the record.
Gently roll the vial between your fingers or swirl it in slow circles. The movement wets the remaining material without vigorous agitation. Let the vial stand briefly if powder remains at the bottom, then repeat the gentle motion. Record the appearance instead of assuming that all powder has dissolved immediately.
Do not shake the vial. The photo shows why this is a poor handling method: fast shaking produces foam and bubbles that make a clear visual check harder. If foam appears, keep the vial upright and allow bubbles to settle before inspecting the liquid again. Gentle rolling is the controlled alternative shown in the previous step.
Hold the vial against a clear background and inspect it under good light. The target visual state is clear liquid without visible powder, flecks or cloudiness. If powder remains, leave the vial to stand for five to ten minutes and swirl gently again. Record a persistent cloudy or particulate appearance rather than treating it as fully dissolved.
Write the preparation date and calculated concentration on the vial. For the 3 mL reference mix, the concentration is 3.33 mg/mL. Store the vial upright in the fridge at 2–8 °C, away from light, use it within about 4 weeks (28 days) and never freeze it.
| Form | Where to keep it | What to record |
|---|---|---|
| Unopened labelled vial | Refrigerated at 2–8 °C and protected from light | Keep product label, batch details and available Quality/COA material together |
| Vial during preparation | Clean, stable work surface with label visible | Final measured liquid volume and calculated concentration |
| Mixed preparation | Upright in a refrigerator at 2–8 °C, protected from light | Preparation date and use within about 4 weeks (28 days) |
| Mixed preparation | Do not freeze | Any cloudiness, particles or handling observation |
PeptideDosages directs refrigeration at 2–8 °C. Once mixed with BAC water, keep Sermorelin 10mg upright in the fridge at 2–8 °C, away from light, use within about 4 weeks (28 days) and never freeze it.
Sermorelin is a synthetic, amidated 29-amino-acid peptide that matches the biologically active GHRH(1-29) fragment of human growth hormone-releasing hormone. It is also called GHRH(1-29)-NH2 or GRF(1-29)-NH2 and is studied for anterior-pituitary and growth-hormone signalling.
Sermorelin 10mg is used for research examining GHRH-responsive pituitary signalling, measured growth-hormone output and downstream hormone-axis questions. The 10mg label identifies the nominal quantity in the vial.
Sermorelin copies the active N-terminal 1–29 part of GHRH. GHRH is a signal from the hypothalamus that acts on the anterior pituitary. In the physiology studies cited on this page, GHRH(1-29)-NH2 prompted measurable growth-hormone release rather than supplying growth hormone itself.
No. Sermorelin is a GHRH fragment that acts upstream at the anterior pituitary. Human growth hormone, also called somatropin, is the separate downstream hormone. They have different chemical identities, study evidence, labelled milligrams and sample documentation.
A 1996 multicentre open-label study in prepubertal children with growth-hormone deficiency reported mean height velocity of 4.1 cm/year before the study, 8.0 after six months and 7.2 after 12 months among 86 participants in the efficacy analysis. This is a paediatric Geref-era result, not a result for this research vial.
A clinical study in 30 healthy men found that GHRH(1-29)-NH2 caused significant growth-hormone release after intravenous administration. The paper reports that the peptide was rapidly eliminated while growth-hormone levels remained elevated for about three hours. These are measured physiology findings in that study setting.
The Mayo Clinic monograph for historical Sermorelin medicine lists pain, redness or swelling at the injection site as more common reactions. It lists dizziness, flushing, headache and sleepiness as less common reactions. Those entries describe a prescription-medicine monograph, not a quality or safety finding for this research vial.
A pharmacokinetic paper reports a 6.2-minute half-life for parent growth hormone-releasing factor(1-29)-amide after intravenous administration in the tested model. Half-life describes disappearance from circulation. It should not be converted into an assumed experimental schedule or storage period.
Specific Sermorelin acetate products were formerly FDA-approved under the Geref name. FDA records show a diagnostic product approved in 1990 and paediatric growth-hormone-deficiency vials approved in 1997. The manufacturer discontinued them in 2008, and FDA withdrew the approvals effective 18 June 2009.
FDA records state that EMD Serono notified the agency in 2008 that it was discontinuing the Geref products and requested withdrawal of the relevant approvals. FDA’s 2013 determination states that the products were not withdrawn from sale for reasons of safety or effectiveness.
No. Historical Geref approval does not make this current Sermorelin 10mg research listing an FDA- or TGA-approved medicine. The TGA describes the ARTG as Australia’s public database of therapeutic goods approved for legal supply. This material is supplied for in-vitro research only.
Yes. WADA places Sermorelin under S2.2.4, growth hormone-releasing factors, alongside GHRH and its analogues. The S2 category is prohibited at all times under the current WADA Prohibited List. This status is separate from the product’s research-use supply boundary.
Sermorelin is the amidated 29-amino-acid GHRH(1-29) fragment. Tesamorelin is a separate stabilised GHRH analogue with 44 amino acids; PubChem lists it at 5,136 g/mol, compared with 3,357.9 g/mol for Sermorelin. Findings for one molecule should not be relabelled as findings for the other.
Sermorelin is GHRH(1-29)-NH2. CJC-1295 NO DAC is a distinct modified GRF(1-29) research molecule. Both have 29 amino acids and are discussed in GHRH-related research.
Sermorelin 10mg can be ordered online from Peak Peptides Australia when available. Same-day dispatch from Victoria for in-stock orders once payment is confirmed, tracked Australia Post Express, with the tracking number emailed. It is supplied for in-vitro research only.
Same-day dispatch from Victoria for in-stock orders once payment is confirmed, tracked Australia Post Express, with the tracking number emailed. Carrier transit time depends on the Australia Post network and destination. The page does not promise a specific delivery date.
Match the product label, product name, nominal amount and supplier details, then read evidence that applies to the actual sample. Identity testing commonly uses LC-MS and purity testing commonly uses HPLC, but a report for a different product does not verify this Sermorelin 10mg vial.
No product-specific LabDoc report is currently published for this listing. Review available Quality/COA documentation on the Quality page. A report needs to identify the material tested, the analytical method and the connection to the supplier.
The 10mg label is the nominal total quantity stated for the vial listing. Laboratory concentration is calculated from material quantity and the final measured liquid volume.
PeptideDosages presents 3 mL of bacteriostatic water as its Sermorelin 10mg calculation example. That produces 3.33 mg/mL. The chart also shows the arithmetic for 1 mL and 2 mL: 10 mg/mL and 5 mg/mL respectively. Changing water changes concentration, not the nominal 10 mg total.
With the 3 mL reference mix, the calculated concentration is 3.33 mg/mL, so 1 mg corresponds to 30 units on a U-100 syringe, or 0.30 mL. With 2 mL, 1 mg corresponds to 20 units; with 1 mL, it corresponds to 10 units.
With the 3 mL reference mix, 10 U-100 units equal 0.10 mL and represent about 0.33 mg, or 33.33 mcg per unit. With a 2 mL mix, 10 units represent 0.5 mg; with a 1 mL mix, 10 units represent 1 mg.
The visual guide shows the handling sequence: gather clean supplies, wipe the rubber stoppers, draw BAC water, let it run down the vial wall, swirl gently, do not shake, check for a fully clear liquid, then label and refrigerate. The 3 mL chart is a concentration calculation example.
Tap water is not a sterile laboratory diluent. PeptideDosages uses bacteriostatic water in its Sermorelin 10mg calculation example. A batch-specific method, product label or Quality/COA documentation governs whether another solvent is appropriate for a defined laboratory procedure.
Let the vial stand for five to ten minutes, then swirl or roll it gently again. Do not shake it. The visual check is simple: a properly dissolved preparation should be clear and without visible powder, flecks or cloudiness. If particles remain, record the observation.
No. In the handling guide, the ready state is a clear liquid with no visible powder, flecks or cloudiness. Cloudiness can mean the material has not fully dissolved or another handling issue is present. Compare the vial against a clear background in good light before recording the result.
Once mixed with BAC water, keep the vial upright in the fridge at 2–8 °C, away from light, and use it within about 4 weeks (28 days). Never freeze it. Write the date and strength on the vial.
Keep the unopened material in the fridge at 2–8 °C, away from light, consistent with the PeptideDosages handling page. Keep the original label and protect the vial from contamination. Follow any more specific conditions in the product packaging or Quality/COA information.
No. Keep the mixed Sermorelin vial upright in the fridge at 2–8 °C, protected from light. Use it within about 4 weeks (28 days) and never freeze it.
A certificate of analysis records what a laboratory tested and how it tested it. Useful details can include sample identity, analytical method, purity result, observed mass, report date and supplier link. It only supports the tested sample, so a COA for another product cannot establish the identity of Sermorelin 10mg.
Scientific background reference
Research references
Science sections summarise the published studies listed above. Test results for this product come from its own lab report.